PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009622248.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 360aa    MW: 40537.5 Da    PI: 7.0507
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009622248.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.1e-171360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l++ ++ +G  +W+++++  g+ R++k+c++rw +yl
   XP_009622248.1 13 RGLWSPEEDEKLIRHITTHGHSCWSSVPKLAGLQRCGKSCRLRWINYL 60
                     788*******************************************97 PP

2Myb_DNA-binding49.87.8e-1666108145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg ++++E+  ++d+++ lG++ W+ Ia++++ gRt++++k++w+
   XP_009622248.1  66 RGCFSEQEERTIIDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWN 108
                      899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-25463IPR009057Homeodomain-like
PROSITE profilePS5129416.958860IPR017930Myb domain
SuperFamilySSF466897.49E-2810107IPR009057Homeodomain-like
SMARTSM007171.1E-121262IPR001005SANT/Myb domain
PfamPF002491.0E-141360IPR001005SANT/Myb domain
CDDcd001679.25E-111660No hitNo description
PROSITE profilePS5129425.28261115IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2464116IPR009057Homeodomain-like
SMARTSM007175.1E-1565113IPR001005SANT/Myb domain
PfamPF002491.6E-1466109IPR001005SANT/Myb domain
CDDcd001677.02E-1169108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGHHCCSKQK VKRGLWSPEE DEKLIRHITT HGHSCWSSVP KLAGLQRCGK SCRLRWINYL  60
RPDLKRGCFS EQEERTIIDV HRILGNRWAQ IAKHLPGRTD NEVKNFWNSA IKKKLIAQGF  120
DPNTHNLLSR NHHQNNKMKN SCKSKTSNYP NSTSVFTIET LSSSKEVGVI SMDIIKASLA  180
ALPPIATTTT ITLPQSQTSW DRPCKSSLTS TTYNYMNPIS VPTTTNMENS NLATIEYQNQ  240
STSNNLLSSS SSLSPSGFGI INENCMWDVT GFEPQLIGPS NGQEEMQLVQ QEGAQLLQLQ  300
ENICQEEVYK VNHEFNNNGQ IAENVTFDNS NFDFEFVDSA LMPCGIYTNV NSIDQLAWDC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30131157108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4779561e-160AF477956.1 Capsicum annuum transcription factor Myb mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622248.10.0PREDICTED: transcription factor MYB86-like
RefseqXP_016470040.10.0PREDICTED: transcription factor MYB86-like
TrEMBLQ71KV11e-163Q71KV1_CAPAN; Transcription factor Myb
STRINGPGSC0003DMT4000188971e-150(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.14e-81myb domain protein 67